PML anticorps (AA 141-179)

N° du produit ABIN5708266

Cet anticorps anti-PML est un anticorps Lapin Polyclonal détectant PML dans WB et IHC (p). Adapté pour Humain, Souris et Rat.

Aperçu rapide pour PML anticorps (AA 141-179) (ABIN5708266)

Antigène: PML (Promyelocytic Leukemia (PML))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PML est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-PML anticorps

Épitope: AA 141-179

Purification: Antigen affinity purified

Immunogène: Amino acids 141-179 (FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLD) from the human protein were used as the immunogen for the PML antibody.

Isotype: IgG

Information d'application

Indications d'application: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the PML antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur PML

Antigène: PML (Promyelocytic Leukemia (PML))

Autre désignation: PML / Promyelocytic leukemia protein

Sujet: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions, all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.

UniProt: P29590

Pathways: Signalisation p53, Retinoic Acid Receptor Signaling Pathway, Maintenance of Protein Location, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus